cDNA Clone VHL

• Synonyms: Von Hippel-Lindau disease tumor suppressor, RCA1, VHL1, HRCA1
• Plasmid: pFBDM-Elongin C, VHL, Elongin B
• Parent Plasmid: pFBDM
• Expressed: VHL
• Genbank: Gene ID 7428
• Species: Human

Sequence of Insert

GCTAGCatgccccggagggcggagaactgggacgaggccgaggtaggcgcggaggaggcaggcgtcgaagagtacggccctgaagaagacggcggggaggagtcgggcgccgaggagtccggcccggaagagtccggcccggaggaactgggcgccgaggaggagatggaggccgggcggccgcggcccgtgctgcgctcggtgaactcgcgcgagccctcccaggtcatcttctgcaatcgcagtccgcgcgtcgtgctgcccgtatggctcaacttcgacggcgagccgcagccctacccaacgctgccgcctggcacgggccgccgcatccacagctaccgaggtcacctttggctcttcagagatgcagggacacacgatgggcttctggttaaccaaactgaattatttgtgccatctctcaatgttgacggacagcctatttttgccaatatcacactgccagtgtatactctgaaagagcgatgcctccaggttgtccggagcctagtcaagcctgagaattacaggagactggacatcgtcaggtcgctctacgaagatctggaagaccacccaaatgtgcagaaagacctggagcggctgacacaggagcgcattgcacatcaacggatgggagattgaGGTACC

Amino Acid Sequence

MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD*

• Vector Type: Baculovirus
• Antibiotic: Amp
• DU Number: DU23347
• Unit Source: Protein Phosphorylation and Ubiquitylation Unit
• Location: PPU
• MTA: Dundee
• Notes: Pme1/AvrII fragment containing elongin B from SC23284 was cloned into Nru1/Spe1 sites of SC23297. Presence of all components confirmed by sequencing (BacF, NW1631 (VHL specific) NW55057 (Elongin B specific) NW1335 (Elongin C specific))